Laboratory sourcing of Sermorelin should start with a chain of evidence: exact GHRH(1-29) identity, the 29-amino-acid sequence, a current lot, HPLC purity, molecular identity testing, an independent laboratory, a COA, and clear Research Use Only status. A bare purity percentage or the phrase "research grade" covers only part of that chain, and the best Sermorelin supplier is the one whose paperwork connects all of it.
This guide addresses research sourcing, peptide identity, and analytical documentation only.
What Is the Best Sermorelin Supplier for Research?
No single company deserves that label without checking the specific batch. The strongest candidates identify the exact GHRH(1-29) peptide and its form, publish a current batch-specific COA from an identifiable independent laboratory showing HPLC purity and a distinct identity result, and keep Research Use Only positioning clear.
What Exactly Is Sermorelin for Research?
Sermorelin is a synthetic 29-amino-acid peptide corresponding to the N-terminal 1-29 fragment of human growth hormone-releasing hormone, written GHRH(1-29) or GRF(1-29). Its sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, with an amidated C-terminus. Per PubChem, the parent peptide carries CAS 86168-78-7, formula C149H246N44O42S, and a molecular weight near 3357.9 g/mol. Suppliers may also write "Sermorelin acetate," a salt form rather than the parent peptide.
Why Exact GHRH(1-29) Identity Matters
A listing saying only "GHRH peptide" does not say which molecule is in the vial. Sermorelin is not interchangeable with full-length GHRH, CJC-1295, or other GHRH analogues, which are chemically distinct materials. A supplier should document the exact 29-residue sequence, C-terminal amidation, a consistent formula and mass, and the current batch, which is why any best Sermorelin supplier comparison starts with the molecule, not the label. Mechanism questions are covered in Bluum's CJC-1295 vs Ipamorelin vs Sermorelin article.
Sermorelin vs. Sermorelin Acetate on Supplier Documentation
Parent Sermorelin and Sermorelin acetate are described differently. Acetate refers to a counterion form, so the applicable CAS number, formula, and molecular weight can differ by form, and the product page and COA should agree on which form was tested. Naming differences are not automatically errors, but where the form is unspecified it is not clearly verified and worth asking about.
What Should a Sermorelin Research COA Confirm?
A Sermorelin COA worth relying on names GHRH(1-29), states the sequence and amidation, specifies the chemical form, and ties a lot number to an analysis date, HPLC purity, and a report reference number. It should include mass spectrometry or LC-MS identity confirmation, name the independent laboratory, and report endotoxin and content data where tested. General COA anatomy is covered in Bluum's field-by-field COA guide.
Why HPLC Purity Cannot Confirm Sermorelin Identity
HPLC purity does not by itself confirm the correct 29-residue sequence, the correct molecular identity, or the correct form. Those require mass spectrometry, LC-MS, or an equivalent identity method run on the same lot. Bluum's peptide purity testing article covers that chemistry.
How We Evaluated Sermorelin Research Suppliers
Each supplier was checked against:
Exact GHRH(1-29) identity, correct sequence, and a clearly stated form
A current lot tied to a COA written for that batch
A purity result alongside an identity result from a different method
A named independent laboratory, test date, and report reference number
Endotoxin, content, and API or source documentation where available
Clear RUO status, with no pharmacy or therapeutic positioning
Ratings stay qualitative (strong Sermorelin documentation, good, partial, or limited evidence, or exact form not clearly verified), and no rating makes a company the best Sermorelin supplier unless the records hold up. Traceability and lab credibility are covered in Bluum's articles on batch-specific COAs and third-party tested peptide companies.
Best Sermorelin Research Suppliers in 2026
A product page does not settle which form or lot sits behind a listing. Scoring competitors without checking their live records would be guesswork, so the table below sets out what the record should show, with Bluum as the single listing checked directly. Telehealth, prescription, and pharmacy brands are excluded by design.
Criterion | What the Record Should Show | Bluum Peptides |
|---|---|---|
Exact GHRH(1-29) Identity | Name, sequence, formula, and mass all specify the 29-residue peptide | Identified as GHRH(1-29), with sequence, formula, MW, and CAS listed |
Current Lot COA | The active batch matched to a COA issued for it | Lot SER52604-66G shown as current, with COA linked |
HPLC Purity | A figure tied to the current lot | 99.41% reported for the current lot |
MS/Identity Testing | An identity result from a different method, same lot | Described generally for each COA; confirm on the lot record |
Independent Lab | Identifiable outside the seller's own pages | Lab partners are named on the page |
Form Documented | Parent peptide or acetate stated consistently | Partial: parent identifiers listed, acetate also appears as a synonym |
Endotoxin Result | A numeric value with its unit for that lot | Reported as ≤ 0.05 EU/mL |
RUO Status | Explicit, not implied | Stated prominently on the page |
Hold any candidate for the best Sermorelin supplier to this table, lot by lot; a research-grade Sermorelin supplier earns that description through records, not wording.
API Documentation vs. Finished Research Vial Documentation
Source or API records can include supplier identity, lot, assay and purity, identity data, manufacturing documentation, the applicable specification, and a COA. Finished-vial records add the final lot, final test, content, and endotoxin where tested. These records support the evaluation of laboratory materials; they do not establish suitability for human or animal use.
Research-Only Scope
This guide evaluates Sermorelin strictly as laboratory material. Research Use Only labeling and analytical documentation do not establish suitability for human or animal consumption.
Red Flags When Comparing Sermorelin Research Suppliers
Watch for a vague "GHRH peptide" label with no GHRH(1-29) designation, a missing sequence, a wrong peptide length, an inconsistent form, a CAS or formula mismatch, HPLC with no identity result, an old COA, no current lot, an unnamed lab, one COA reused across lots, historical FDA approval presented as if a research product were approved, research material described as suitable for compounding, and telehealth, prescription, or therapeutic claims in research-only copy.
Each is better read as a documentation gap than as proof of misconduct: the record is insufficient to verify the claim as stated, which warrants a question to the supplier.
How Bluum Peptides Documents Sermorelin
Bluum's live Sermorelin page identifies the material as GHRH(1-29), with the sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR, formula C149H246N44O42S, molecular weight approximately 3357.96 g/mol, and CAS 86168-78-7, in 5 mg and 10 mg sizes. The current lot, SER52604-66G, shows 99.41% purity with a linked COA; its endotoxin report lists ≤ 0.05 EU/mL, all under prominent Research Use Only terms. The site also states it is a chemical supplier, not a 503A compounding pharmacy or 503B outsourcing facility.
Two details merit confirmation on the COA: the listed identifiers match the parent peptide while the synonym row also includes acetate terminology, and the sequence line omits the C-terminal amide. By this article's criteria, current-lot evidence is strong and form documentation partial. This does not rank Bluum as the best Sermorelin supplier; it reports what the records show, and the COA lookup tool allows independent lot verification.
How Researchers Should Compare Sermorelin Suppliers
Choosing the best Sermorelin supplier for research comes down to twelve checks:
Confirm the listing identifies GHRH(1-29), not just "GHRH peptide."
Verify the exact 29-residue sequence.
Check parent-peptide versus acetate wording.
Pull the current lot's COA.
Review HPLC purity.
Confirm separate molecular identity evidence.
Check the laboratory, date, and report number.
Review endotoxin and content data where relevant.
Evaluate API or source documentation if applicable.
Confirm Research Use Only status.
Keep supplier evaluation focused on laboratory sourcing and analytical documentation.
Repeat the check each time a new lot is released.
Frequently Asked Questions
What is the best Sermorelin supplier for research?
One that names GHRH(1-29) and its form, publishes a current batch-specific COA, and pairs HPLC purity with a distinct identity result while keeping RUO status clear.
What is Sermorelin?
A synthetic 29-amino-acid peptide corresponding to the N-terminal 1-29 fragment of human growth hormone-releasing hormone.
Is Sermorelin the same as GHRH(1-29)?
Yes. Sermorelin is the 1-29 fragment, which is chemically distinct from full-length GHRH.
How many amino acids are in Sermorelin?
Twenty-nine, with an amidated C-terminus.
What sequence should Sermorelin have?
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2.
What should a Sermorelin COA contain?
The GHRH(1-29) identity, sequence, form, lot number, analysis date, HPLC purity, an identity result, the laboratory, and a report reference number.
Is HPLC enough to verify Sermorelin?
No. HPLC supports purity but cannot confirm sequence, identity, or form without a separate method such as LC-MS.
What is the difference between Sermorelin and Sermorelin acetate?
Sermorelin is the parent peptide; Sermorelin acetate names an acetate salt form, so CAS, formula, and MW can differ.
What makes a Sermorelin research supplier reputable?
One whose form-specific records stay consistent across current stock, with independent testing behind them and claims kept within what the records support.
For research and laboratory use only. Not for human or animal consumption.
