A Tesamorelin listing earns trust only when its paperwork links one chain: the exact peptide, its 44-residue sequence and N-terminal modification, the current lot, purity, a separate identity result, a named independent lab, and a COA covering all of it under Research Use Only terms. A bare purity figure supplies one link at most, and the best Tesamorelin supplier can show the whole chain.
This guide addresses research sourcing, peptide identity, and analytical documentation only.
What Is the Best Tesamorelin Supplier for Research?
Look for a supplier that names Tesamorelin as the hexenoyl-modified 44-amino-acid peptide, states its chemical form, and supports the current lot with a COA issued by an independent lab, showing HPLC purity alongside a separate identity result, all under clear Research Use Only terms.
What Exactly Is Tesamorelin?
Tesamorelin is a synthetic, hexenoyl-modified analogue of human GHRH (growth hormone-releasing hormone), 44 amino acids long, with the sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL and a trans-3-hexenoyl group on the N-terminal tyrosine. Per PubChem, it carries CAS 218949-48-5, formula C221H366N72O67S, a molecular weight near 5136 g/mol, and CID 16137828; the acetate form has its own record. For structure, stability, and biology, see Bluum's Tesamorelin research guide.
Why the N-Terminal Modification Matters for Supplier Verification
A "GHRH analog" or "44 amino acids" label does not show which molecule is sold. The hexenoyl group on the N-terminal tyrosine separates Tesamorelin from unmodified human GHRH(1-44), so identity evidence should reflect it: the correct sequence, a measured mass consistent with the modified structure, and an identity result specific to Tesamorelin. Any best Tesamorelin supplier comparison turns on whether the report supports that identity. The 29-residue peptide in Bluum's Sermorelin supplier guide is a different material.
Tesamorelin vs. Tesamorelin Acetate on a COA
Free-base Tesamorelin and Tesamorelin acetate are reported differently. The acetate carries counterions, so CAS number, formula, and weight can change with the form, and content may be stated as parent peptide, salt, or free-base equivalent. COA and product page should match; the working question is what chemical form the analytical report describes.
What Should a Tesamorelin Research COA Confirm?
A Tesamorelin supplier COA worth keeping states the compound name, the 44-residue sequence, the N-terminal modification, and the chemical form, then attaches the lot, when it was tested, its HPLC purity, and a report reference. An orthogonal identity result such as LC-MS, the independent laboratory's name, and content or endotoxin data where measured complete the record. General COA reading is covered in Bluum's COA interpretation guide.
Why HPLC Purity Alone Cannot Verify Tesamorelin
A high HPLC figure leaves the full 44-residue sequence, the N-terminal modification, molecular identity, and form unconfirmed. Mass spectrometry or LC-MS on the same lot supplies that. Both methods are explained in Bluum's peptide purity testing guide.
How We Evaluated Tesamorelin Research Suppliers
Every listing was measured against:
Tesamorelin named exactly, with the 44-residue sequence displayed
The hexenoyl modification identified
Parent or acetate form stated, with CAS, formula, and weight agreeing
The current lot matched to its own batch COA
HPLC purity plus an identity result from another method
A named laboratory, test date, and report reference
Endotoxin, content, or API source records where offered
RUO framing throughout, free of prescription or human-use language
Ratings stay qualitative, from strong documentation down to limited public evidence, with unverified Tesamorelin identity lowest. A rating alone never makes a company the best Tesamorelin supplier; the records must hold up. Lot tracing is covered in Bluum's batch-specific COA article, and lab credibility in its third-party tested peptide companies guide.
Best Tesamorelin Research Suppliers in 2026
Listings alone cannot reveal which modification, salt form, or lot is in the vial. Without checking competitors' live records, any scoring would be speculation, so the table lists what a solid record contains and sets Bluum, the one listing inspected directly, beside it. Pharmaceutical makers, pharmacies, and telehealth brands are excluded.
Criterion | Evidence to Look For | Bluum Peptides |
|---|---|---|
44-AA Identity | Tesamorelin named as the 44-residue analog, sequence displayed | Called a 44-amino-acid GHRH analog; sequence absent from the specification table |
Modification Documented | Hexenoyl group on the N-terminal tyrosine identified | Partial: shows up in chemical synonyms, with no explanation in the specifications |
Current Lot COA | Production lot paired with its own COA | Lot TES52606-92G marked current, COA linked |
HPLC Purity | A percentage attached to that lot | 99.47% for the current lot |
Identity Testing | A second analytical method confirming the molecule | General description per COA; verify on the lot record |
Independent Lab | An outside party named in the documentation | Testing partners named on the page |
Form Clear | Parent or acetate declared, numbers consistent with it | Two CAS numbers listed with a free-base weight; confirm the tested form on the COA |
RUO Status | Stated outright | Displayed prominently on the page |
Apply the table to each candidate for the best Tesamorelin supplier, one lot at a time; a research-grade Tesamorelin supplier is defined by its records, not its adjectives.
Research-Only Scope
This guide evaluates Tesamorelin strictly as laboratory material. Research Use Only labeling and analytical documentation do not establish suitability for human or animal consumption.
Research Source Documentation
Research source documentation should identify the chemical material, lot, purity, molecular identity, and analytical report. Researchers should evaluate these records alongside the finished-vial COA. The records support laboratory sourcing only and do not establish suitability for human or animal use.
Red Flags When Comparing Tesamorelin Research Suppliers
Warning signs include a "GHRH peptide" label with no detail, the wrong peptide length, a missing 44-residue sequence, identity papers that omit the N-terminal modification, a product page and COA split on parent versus acetate, wrong CAS, formula, or weight, HPLC without an identity result, an unnamed lab, no identifiable current lot, an outdated or generic COA, a claim that the RUO product is itself FDA approved, a prescription drug's approval borrowed to market research material, RUO material called an authorized compounding API without proof, and pharmacy, prescription, human-use, or therapeutic claims on a research listing.
A flag marks missing evidence, not guilt: when the record cannot verify the claim, ask the vendor to produce it before drawing a conclusion.
How Bluum Peptides Documents Tesamorelin
Bluum's live Tesamorelin page lists 5, 10, and 20 mg sizes, formula C221H366N72O67S, CAS 218949-48-5 for the free base and 901758-09-6 for the acetate salt, and a free-base molecular weight of 5136 g/mol. Its synonym row lists TH9507 and chemical names identifying the (3E)-hex-3-enoyl group, the page's documentation of the defining modification. The current lot, TES52606-92G, is labeled current at 99.47% purity with a linked COA and prominent Research Use Only terms. Its disclaimer also separates Bluum from 503A compounding pharmacies and 503B outsourcing facilities.
Three details deserve confirmation on the COA: the 44-residue sequence is absent from the specification table; two CAS numbers sit beside a free-base weight, so the tested form should be stated; and the linked endotoxin report's lot number and units should be checked against the current lot. By this article's criteria, current-lot purity evidence is strong while sequence, form, and endotoxin documentation are partial. None of this ranks Bluum as the best Tesamorelin supplier; the COA lookup lets a researcher verify the lot independently.
How Researchers Should Compare Tesamorelin Suppliers
A researcher choosing the best Tesamorelin supplier can work through twelve checks:
Check that the listing names Tesamorelin itself, not a generic GHRH analog.
Verify the 44-residue sequence.
Look for the N-terminal modification.
Settle parent versus acetate wording.
Open the COA for the current lot.
Read the HPLC purity.
Find a separate identity result.
Note the lab, date, and report number.
Check content and endotoxin data where relevant.
Weigh API or source records if present.
Confirm strict Research Use Only status.
Start over whenever the lot changes.
Frequently Asked Questions
What is the best Tesamorelin supplier for research?
One that documents the modified 44-amino-acid structure and its chemical form, backs purity with a separate identity result, and ties both to a current batch COA.
What is Tesamorelin?
A synthetic 44-amino-acid GHRH analogue that carries an N-terminal trans-3-hexenoyl group.
How many amino acids are in Tesamorelin?
Forty-four.
What sequence should Tesamorelin have?
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, with the hexenoyl group on the N-terminal tyrosine.
What modification distinguishes Tesamorelin from native GHRH?
A trans-3-hexenoyl group attached to the N-terminal tyrosine.
What should a Tesamorelin COA contain?
The compound name, sequence, modification, chemical form, lot, testing date, HPLC result, an orthogonal identity result, the lab, and a report reference.
Is HPLC enough to verify Tesamorelin?
Not by itself. HPLC speaks to purity, while the sequence, the modification, and the form need a second method, typically mass spectrometry.
What is the difference between Tesamorelin and Tesamorelin acetate?
Tesamorelin is the parent peptide; the acetate is a salt, so CAS, formula, and weight can differ.
What makes a Tesamorelin research supplier reputable?
Records that agree from product page to COA, lot after lot, backed by independent testing and no claims beyond the documents.
For research and laboratory use only. Not for human or animal consumption.
